PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009930
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 216aa    MW: 23106.3 Da    PI: 8.7224
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009930genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601331.2e-41231221100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++pe++r da++slvyeA+ r+rdPvyG++g i++lqq++++l++el++++
  Lus10009930  23 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLLEVPESQRADAANSLVYEANLRLRDPVYGCMGAISALQQEIQSLQTELNAVR 120
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Lus10009930 121 SE 122
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.90722123IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4123120IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MGRRSVVMMN MISPPGVLNT VTPCAACKLL RRRCAEECPF SPYFSPHEPH KFAAVHKVFG  60
ASNVSKMLLE VPESQRADAA NSLVYEANLR LRDPVYGCMG AISALQQEIQ SLQTELNAVR  120
SEILKYKYRE ATTSLLSSAA HASLISSGVV SVIAPTTPVP PPRTPTLAPP PPPPPQPSIV  180
ISSSSSSTNA SNNNNNNLYS SITASDRHSG VPYFD*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012091188.14e-85PREDICTED: LOB domain-containing protein 15
SwissprotQ9AT614e-76LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A067JNV94e-85A0A067JNV9_JATCU; Uncharacterized protein
STRINGVIT_06s0004g07790.t014e-82(Vitis vinifera)
STRINGVIT_13s0067g02380.t013e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-75LOB domain-containing protein 13